PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG558700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 233aa    MW: 25640.7 Da    PI: 6.1743
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG558700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.65.1e-1957110356
                          --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          k++++++eq+e Le  F+++r++ + ++ +LA++lgL+ +qV vWFqNrRa++k
  Pavir.2NG558700.1.p  57 KKRRLSDEQVEMLELSFREERKLETGRKVHLAAELGLDPKQVAVWFQNRRARHK 110
                          45589***********************************************99 PP

2HD-ZIP_I/II116.31.8e-3757147292
          HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                          kkrrls+eqv++LE sF+ee+kLe+ rKv+la eLgl+p+qvavWFqnrRAR+k+k lE+++++Lk+a+da   ++++Le+ev +L+e+l
  Pavir.2NG558700.1.p  57 KKRRLSDEQVEMLELSFREERKLETGRKVHLAAELGLDPKQVAVWFQNRRARHKSKLLEEEFAKLKQAHDAAILHKCHLENEVMRLKERL 146
                          9**************************************************************************************998 PP

          HD-ZIP_I/II  92 k 92 
                          +
  Pavir.2NG558700.1.p 147 E 147
                          6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.79E-1751111IPR009057Homeodomain-like
PROSITE profilePS5007116.27752112IPR001356Homeobox domain
SMARTSM003894.9E-1755116IPR001356Homeobox domain
CDDcd000863.45E-1657112No hitNo description
PfamPF000462.6E-1657110IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.7E-1857110IPR009057Homeodomain-like
PRINTSPR000311.2E-58392IPR000047Helix-turn-helix motif
PROSITE patternPS00027087110IPR017970Homeobox, conserved site
PRINTSPR000311.2E-592108IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MEQYDELFPP AYVDSSNLLV PNGAAQGERP RARRRRRRAA RCGGGGDGEL DGGGDPKKRR  60
LSDEQVEMLE LSFREERKLE TGRKVHLAAE LGLDPKQVAV WFQNRRARHK SKLLEEEFAK  120
LKQAHDAAIL HKCHLENEVM RLKERLEVTE EELARVRSAA GSHAVSGDGG DAMGRVVCSG  180
SPSSSFSTGT CQQPCVGGGD HLGDDELLYV PDYAYADNSV VEWFSLYGIG LM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12837RPRARRRRRR
23240RRRRRRAAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0399590.0BT039959.1 Zea mays full-length cDNA clone ZM_BFc0054M14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958136.11e-112PREDICTED: homeobox-leucine zipper protein HOX14
SwissprotQ7XI857e-92HOX14_ORYSJ; Homeobox-leucine zipper protein HOX14
TrEMBLK3ZWM71e-112K3ZWM7_SETIT; Uncharacterized protein
STRINGSi031009m1e-111(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP200638101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.19e-38homeobox protein 40